Recombinant LIF, Mouse
CNY 1890.00
货期*
2周
规格
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF with polyhistidine tag at the N-terminus.
|
| Tag | His Tag (N-term) |
| Predicted MW | The protein has a calculated MW of 20.68 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >95% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to induce IL-6 secretion in M1 cells. The ED₅₀ for this effect is <0.5 ng/mL. The specific activity of recombinant mouse LIF is > 2 x 10⁶ IU/mg. |
| Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | P09056 |
| Synonyms | leukemia inhibitory factor, Differentiation-stimulating factor, D factor, Melanoma-derived LPL inhibitor (MLPLI), Interleukin 6 family cytokine |
| Summary | Leukemia inhibitory factor (LIF) is a pleiotropic glycoprotein, belonging to the IL-6 receptor family. Mouse LIF shares 79% sequence homology with human LIF. LIF is a 19.7 kDa protein containing 202 amino acid which high expression in human liver, bone, uterus, kidney and the central nervous system. LIF is a inducer of differentiation in M1 leukaemia cells, osteoblasts and glia. Not only stimulates proliferation of DA1 cells inhibit proliferation of corticotrophs and promote cell survival in some cell types but also induces apoptosis in others. |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
