Recombinant IL-25 (Interleukin-25),Mouse

CAT#: TP728348

Recombinant IL-25 (Interleukin-25),Mouse

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 1890.00


货期*
2周

规格
    • 20 ug

Product images

Specifications

Product Data
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MVSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 18.41kDa. The protein migrates about 17 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measured by its ability to induce CXCL1 secretion in HT‑29 cells. The ED₅₀ for this effect is <1 ng/mL
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
RefSeq NP_542767 1
Synonyms IL-17E, Il17e
Summary Interleukin 25 (IL-25) is a cytokine with proinflammatory and anti-inflammatory effects, it predicts a molecular mass of 16.7 kDa. It can induce NF-κB activation, and stimulate the production of IL-8, which is the major chemotactic substance of neutrophils.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...