Recombinant IL-18 (Interleukin-18), Mouse
CAT#: TP728340M
Recombinant IL-18 (Interleukin-18), Mouse
Need it in bulk or customized? Get a free quote |
CNY 4880.00
货期*
2周
规格
Specifications
Product Data | |
Species | Mouse |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS with polyhistidine tag at the C-terminus.
|
Tag | His Tag (C-term) |
Predicted MW | The protein has a calculated MW of 19.1 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis). |
Purity | >98% as determined by SDS-PAGE. |
Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. |
Applications | Cell culture |
Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
Bioactivity | Measure by its ability to induce IFN gamma secretion in KG-1 cells. The ED₅₀ for this effect is <0.5 μg/mL. |
Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
Reference Data | |
UniProt ID | P70380 |
Synonyms | IGIF |
Summary | Interleukin-18 (IL-18) belongs to the IL-1 superfamily and is constitutively produced by macrophages, dendritic cells (DCs) and other cells. IL-18 binds to the receptor of IL-18 (IL-18R) and initiate the recruitment and heterodimerization of the IL-18RAcP, leading to downstream activation of NF-κB. After stimulation with IL-18, multiple cytokines including IFN-γ, IL-13, IL-4, IL-8, and GM-CSF and both Th1 and Th2 lymphokines could be produced by different cells. As an immunoregulaory cytokine, IL-18 can promote development of T helper 1 (Th1) cells, which maximizes the production of IFN by synergistically stimulating to mature Th1 effectors in combination with IL-12. On the contrary, it inhibits the production of the anti-inflammatory cytokine IL-10. In addition, IL-18 exhibits multiple proinflammatory functions, such as increases in cell adhesion molecules, nitric oxide synthesis, and chemokine production. |
Documents
FAQs |
SDS |
Customer
Reviews
Loading...