Recombinant IL-17B (Interleukin-17B), Mouse
CAT#: TP728338
Recombinant IL-17B (Interleukin-17B), Mouse
|
Need it in bulk or customized? Get a free quote |
CNY 1890.00
货期*
2周
规格
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
MHPRNTKGKRKGQGRPSPLAPGPHQVPLDLVSRVKPYARMEEYERNLGEMVAQLRNSSEPAKKKCEVNLQLWLSNKRSLSPWGYSINHDPSRIPADLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPQPPRPGPCRQRVVMETIAVGCTCIF with polyhistidine tag at the C-terminus.
|
| Tag | His Tag (C-term) |
| Predicted MW | The protein has a calculated MW of 18.99 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >98% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to induce IL-8 secretion in HepG2 cells. The ED₅₀ for this effect is <1.5 ng/mL. |
| Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | Q9QXT6 |
| Synonyms | 1110006O16Rik, 1700006N07Rik, Zcyto, Zcyto7 |
| Summary | Interleukin 17B (IL-17B) predicts a molecular mass of 20.4 kDa, is expressed in several peripheral tissues and immune tissues. In contrast to the high level of IL-6 secretion stimulated by IL-17A, IL-17B failed to induce IL-6 secretion in fibroblasts; however, it significantly enhanced the TNF-α-induced production of G-CSF and IL-6 in the fibroblasts. |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
