Recombinant IL-17A (Interleukin-17A), Mouse
CAT#: TP728337L
Recombinant IL-17A (Interleukin-17A), Mouse
|
Need it in bulk or customized? Get a free quote |
CNY 22000.00
货期*
2周
规格
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA with polyhistidine tag at the C-terminus.
|
| Tag | His Tag (C-term) |
| Predicted MW | The protein has a calculated MW of 15.92 kDa. The protein migrates about 17 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >98% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED₅₀ for this effect is <1 ng/mL. The specific activity of recombinant mouse IL-17A is > 1 x 10⁶ IU/mg. |
| Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | Q62386 |
| Synonyms | CTLA-8 |
| Summary | Interleukin 17A (IL-17A) predicts a molecular mass of 35 kDa, encoded IL17A gene is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappa B and mitogen-activated protein kinases. |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
