Recombinant IGF-II (Insulin-like growth factor-II), Mouse

CAT#: TP728328L

Recombinant IGF-II (Insulin-like growth factor-II), Mouse

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 22000.00


货期*
2周

规格
    • 1 mg

Product images

Specifications

Product Data
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence
AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE with polyhistidine tag at the N-terminus.
Tag His Tag (N-term)
Predicted MW The protein has a calculated MW of 8.20 kDa. The protein migrates about 11 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce MCF-7 cells proliferation. The ED₅₀ for this effect is <6 ng/mL. The specific activity of recombinant mouse IGF-II is > 1.5 x 10⁵ IU/mg.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P09535
Synonyms AL033362, Igf-2, M6pr, Mpr, Peg, Peg2
Summary Mouse Insulin Like Growth Factors 2 (IGF-II) is a 7.34 kDa member of the Insulin-like Growth Factors with 67 amino acid residues. IGF-II is mainly expressed from early embryonic somatic tissues, liver, and epithelial cells lining the surface of the brain. IGF-II is mediating the embryonic development and placental growth, while also promoting tumor growth. IGF-II affects regulation of cell proliferation, growth, migration, differentiation and survival via binding to IGF-I receptor.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...