Recombinant IFN alpha 1a (Interferon alpha 1a), Mouse

CAT#: TP728324S

Recombinant IFN alpha 1a (Interferon alpha 1a), Mouse

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 700.00


货期*
2周

规格
    • 5 ug

Product images

Specifications

Product Data
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence
CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK with polyhistidine tag at the N-terminus.
Tag His Tag (N-term)
Predicted MW The protein has a calculated MW of 19.93 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to protect L929 cells infected with encephalomyocarditis (EMC) virus. The ED₅₀ for this effect is <10 pg/mL. The specific activity of recombinant mouse IFN alpha 1a is > 4 x 10⁷ IU/mg.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P01572
Synonyms Ifa, Ifa8
Summary Interferon Alpha 1a (IFN alpha 1a) is a leukocyte interferon, which is a variant of Interferon-alpha. IFN-alpha 1a is a 18.4 kDa protein containing 166 amino acid residues. It could bind the interferon receptors that activates the signal transduction of immune responses through the Jak/STAT pathway in leukocytes and lymphoblastoid cells.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...