Recombinant Flt-3 Ligand (Fms-related tyrosine kinase-3 ligand), Mouse
CAT#: TP728320
Recombinant Flt-3 Ligand (Fms-related tyrosine kinase-3 ligand), Mouse
|
Need it in bulk or customized? Get a free quote |
CNY 1890.00
货期*
2周
规格
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
MGTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPR with polyhistidine tag at the C-terminus.
|
| Tag | His Tag (C-term) |
| Predicted MW | The protein has a calculated MW of 19.3 kDa. The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >98% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to induce proliferation in BaF3 cells transfected with mouse Flt-3. The ED₅₀ for this effect is <2 ng/mL. |
| Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | P49772 |
| Synonyms | Fetal liver kinase 2, FLK-2 |
| Summary | Fms-related tyrosine kinase-3 ligand (Flt-3 Ligand) is a protein which is encoded by the Flt3lg gene in mouse. As an important regulator of hematopoiesis, Flt-3 ligand has a tyrosine-protein kinase activity that stimulate the proliferation of hematopoietic progenitor cells of both lymphoid and myeloid origin. Flt-3 ligand can synergistically increase the proliferation of immature progenitors with other cytokines such as GM-CSF, G-CSF, IL-3, EPO, IL-11, IL-12, IL-6 or TPO. Flt-3 ligand is expressed by a variety of hematopoietic progenitor cells including immature hematopoietic and marrow stromal cells. |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
