Recombinant CXCL12 (C-X-C motif chemokine 12),Mouse
CAT#: TP728308S
Recombinant CXCL12 (C-X-C motif chemokine 12),Mouse
|
Need it in bulk or customized? Get a free quote |
CNY 700.00
货期*
2周
规格
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
MGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK with polyhistidine tag at the C-terminus.
|
| Tag | His Tag (C-term) |
| Predicted MW | The protein has a calculated MW of 8.97 kDa. The protein migrates below 8-11 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >98% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to chemoattract BaF3 cells transfected with human CXCR4. The ED₅₀ for this effect is <0.5 ng/mL. |
| Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | P40224 |
| Synonyms | PB, PBSF/SD, Pbsf, SDF-, Scyb1, Scyb12, Sdf, Sdf1, TLS, TP, Tlsf, Tpar1 |
| Summary | C-X-C motif chemokine 12 (CXCL12) also named stromal cell-derived factor 1 (SDF-1), which is a chemokine of the intercrine alpha family. CXCL12 is a 7.8 kDa protein containing 70 amino acid residues. CXCL12 has a key role in controling the immune responses which is often induced by the lipopolysaccharide or IL-1. CXCL12 also activates the leukocytes during inflammation. CXCL12 induces the migration and proliferation of cells like hematopoietic progenitor, stem cells and leukocytes. |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
