Recombinant CCL2 (C-C motif chemokine ligand 2), Mouse

CAT#: TP728300M

Recombinant CCL2 (C-C motif chemokine ligand 2), Mouse

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 4880.00


货期*
2周

规格
    • 100 ug

Product images

Specifications

Product Data
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence
QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN with polyhistidine tag at the N-terminus.
Tag His Tag (N-term)
Predicted MW The protein has a calculated MW of 14.65 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to chemoattract BaF3 cells transfected with CCR2A. The ED₅₀ for this effect is <8 ng/mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P10148
Synonyms Monocyte Chemotactic Protein-1,MCP-1,JE
Summary C-C Motif Chemokine Ligand 2 (CCL2) is a 13.88 kDa cytokine with 125 amino acid residues and is also known as monocyte chemoattractant protein 1 (MCP1). CCL2 is mainly secreted from monocytes, macrophages, and dendritic cells. It regulates many biological functions, such as recruitments of monocytes, memory T cells, eosinophils, and dendritic cells, extravasation of helper T cells, response to TNFα and IFNγ, and angiogenesis. In addition, upon binding with CCR4, it initiates leukocyte migration response to inflammation.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...