Recombinant VEGF121 (Vascular endothelial growth factor 121), Human
CAT#: TP728293M
Recombinant VEGF121 (Vascular endothelial growth factor 121), Human
|
Need it in bulk or customized? Get a free quote |
CNY 4880.00
货期*
2周
规格
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
MAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENCDKPRR with polyhistidine tag at the C-terminus.
|
| Tag | His Tag (C-term) |
| Predicted MW | The protein has a calculated MW of 15.00 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >95% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to induce proliferation in HUVEC cells. The ED₅₀ for this effect is <2.5 ng/mL. |
| Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | PDB: 3V2A_A |
| Synonyms | VPF |
| Summary | Vascular Endothelial Growth Factors 121(VEGF121) is one of five VEGF splice variants of 121, 145, 165, 183, 189, and 206 amino acids (aa) in length. VEGF121 is the only VEGF which lacks heparin-binding activity and freely diffusible. VEGF binds the type I transmembrane receptor tyrosine kinases VEGF R1 (also called Flt-1) and VEGF R2 (Flk-1 /KDR) on endothelial cells to activate signal transduction and regulate both physiological and pathological angiogenesis. |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
