Recombinant TNF beta (Tumor necrosis factor beta), Human
CAT#: TP728290M
Recombinant TNF beta (Tumor necrosis factor beta), Human
|
Need it in bulk or customized? Get a free quote |
CNY 4880.00
货期*
2周
规格
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL with polyhistidine tag at the N-terminus.
|
| Tag | His Tag (N-term) |
| Predicted MW | The protein has a calculated MW of 18.65 kDa. The protein migrates as 21 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >98% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to induce cytotoxicity in L929 cells in the presence of actinomycin D. The ED₅₀ for this effect is <3 pg/mL. The specific activity of recombinant human TNF beta is > 3.3x 10⁸ IU/mg. |
| Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | P01374 |
| Synonyms | TNFSF1B, Lymphotoxin-alpha (LT-α),LTA |
| Summary | Human TNF beta (Lymphotoxin-alpha) is a 22 kDa cytokine with 205 amino acid residues. TNF beta belongs to tumor necrosis factor (TNF) superfamily as TNF alpha. Binding to lymphotoxin-β receptor (LtβR), canonical and non-canonical NF-κB signal pathway will be activated. TNF beta is related to apoptosis and inflammatory signals |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
