Recombinant SCF, Human
CNY 1890.00
货期*
2周
规格
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA with polyhistidine tag at the C-terminus
|
| Tag | His Tag (C-term) |
| Predicted MW | The protein has a calculated MW of 19.4 kDa. The protein migrates as 21 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >98% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to induce TF-1 cells proliferation. The ED₅₀ for this effect is <5 ng/mL. The specific activity of recombinant human SCF is > 5 x 10⁵ IU/mg. |
| Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | P21583 |
| Synonyms | DCUA, DFNA69, FPH2, FPHH, KL-1, Kitl, MGF, SF, SHEP7, SLF, KIT ligand |
| Summary | Stem Cell Factor (SCF) is a 166-amino-acid protein with a monomeric molecular weight of approximately 18.5 kDa. SCF is the ligand for the tyrosine kinase receptor c-kit, which regulates other Growth Factorss, such as granulocyte colony-stimulating factor (G-CSF), granulocyte macrophage-colony-stimulating factor (GM-CSF), and interleukin-3 to stimulate proliferation, and differentiation of hematopoietic stem cells. SCF can be produced by a variety of cells, including fibroblasts, smooth muscle, endothelial cells, mast cells and bone marrow macrophages endothelial cells. |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
