Recombinant IL-9 (Interleukin-9),Human
CAT#: TP728274S
Recombinant IL-9 (Interleukin-9),Human
|
Need it in bulk or customized? Get a free quote |
CNY 700.00
货期*
2周
规格
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI with polyhistidine tag at the N-terminus.
|
| Tag | His Tag (N-term) |
| Predicted MW | The protein has a calculated MW of 14.93 kDa. The protein migrates as 13-17 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >98% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to induce proliferation in MO7e cells. The ED₅₀ for this effect is <0.25 ng/mL. The specific activity of recombinant human IL-9 is approximately >5 x10⁶ IU/ mg. |
| Endotoxin | <0.01 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | P15248 |
| Synonyms | p40 cytokine, T-cell growth factor p40, HP40 |
| Summary | Interleukin 9 (IL-9) is a pleiotropic cytokine that had pleiotropic functions in the immune system, has a molecular mass of 14.5 kDa. The major source of IL-9 is T lymphocytes. It is secreted by CD4+ helper cells that acts as a regulator of a variety of hematopoietic cells. |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
