Recombinant IL-7 (Interleukin-7),Human
CAT#: TP728272S
Recombinant IL-7 (Interleukin-7),Human
|
Need it in bulk or customized? Get a free quote |
CNY 700.00
货期*
2周
规格
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
MDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH with polyhistidine tag at the C-terminus.
|
| Tag | His Tag (C-term) |
| Predicted MW | The protein has a calculated MW of 18.3 kDa. The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >95% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBMC). The ED₅₀ for this effect is <0.8 ng/mL. The specific activity of recombinant human IL-7 is > 1 x 10⁸ IU/mg. |
| Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | P13232 |
| Synonyms | Lymphopoietin 1(LP-1), pre-B-cell factor |
| Summary | Interleukin-7 (IL-7) is a multipotent cytokine belonged to one of the members of IL-2 superfamily. IL-7 has diverse effects on the hematopoietic and immune regulations. IL-7 is a trophic factor that is necessary for both B cell and T cell proliferation and development. In addition, it presents potential antitumor effects in tumors such as glioma, melanoma, lymphoma, leukemia, prostate cancer, and glioblastoma. |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
