Recombinant IL-32 alpha (Interleukin-32 alpha), Human

CAT#: TP728261L

Recombinant IL-32 alpha (Interleukin-32 alpha), Human

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 22000.00


货期*
2周

规格
    • 1 mg

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK with polyhistidine tag at the C-terminus .
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 15.72 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce TNF alpha secretion in RAW264.7 cells. The ED₅₀ for this effect is <10 μg/mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P24001-4
Synonyms IL-32alpha, IL-32beta, IL-32delta, IL-32gamma, NK4, TAIF, TAIFa, TAIFb, TAIFc, TAIFd
Summary Interleukin 32 alpha (IL-32α) is an 18 kDa cytokine with 131 amino acid residues and one of the IL-2 splice variants. IL-32α is primarily secreted from inflammatory cells, such as NK cells, T-cells, peripheral blood mononuclear cells (PBMCs), and monocytes. IL-32 alpha is a proinflammatory cytokine regulating IL-6 by interaction with protein kinase C(PKC). It also interacts with paxillin, integrin, and focal adhesion kinase 1 (FAK 1).
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...