Recombinant IL-3 (Interleukin-3),Human

CAT#: TP728259

Recombinant IL-3 (Interleukin-3),Human

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 1890.00


货期*
2周

规格
    • 20 ug

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MAPMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 16 kDa. The protein migrates as 13 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce TF-1 cells proliferation. The ED₅₀ for this effect is <0.15 ng/mL. The specific activity of recombinant human IL-3 is approximately >1.2 x 10⁶ IU/mg.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P08700
Synonyms MCGF (Mast Cell Growth Factor), Multi-CSF, HCGF, P-cell stimulation factor, Interleukin-3b
Summary Interleukin-3 (IL-3) is a pleiotropic cytokine which can stimulates the survival, differentiation and proliferation of committed progenitor cells, including megakaryocyte, granulocyte-macrophage, erythroid, eosinophil, basophil and mast cell lineages. IL-3 also enhances phagocytosis and antibody-mediated cellular cytotoxicity. IL-3 binds to IL-3R (IL-3 receptor), which is composed of a unique α subunit (IL-3Rα) and a common β-subunit (βc).
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...