Recombinant IL-28B (Interleukin-28B), Human
CAT#: TP728257L
Recombinant IL-28B (Interleukin-28B), Human
|
Need it in bulk or customized? Get a free quote |
CNY 22000.00
货期*
2周
规格
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
MVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV with polyhistidine tag at the C-terminus.
|
| Tag | His Tag (C-term) |
| Predicted MW | The protein has a calculated MW of 25.57 kDa. The protein migrates as 21 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >95% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED₅₀ for this effect is <5 ng/mL. |
| Endotoxin | <0.01 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | Q8IZI9 |
| Synonyms | interferon lambda 3, IFNL3, IFN-lambda-3, IFN-lambda-4, IL-28C, IL28C |
| Summary | Interleukin-28B (IL-28B, now known as Interferon Lambda 3, IFN-λ3) is a 19.77 kDa member of type III IFN family with 176 amino acid residues. IL-28B is expressed by epithelial tissues. Cytokine with antiviral, antitumor and immunomodulatory activities. Able to activate JAK/STAT signaling pathway via binding its receptor IFNLR1 in epithelial cells. |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
