Recombinant IL-21 (Interleukin-21), Human

CAT#: TP728249

Recombinant IL-21 (Interleukin-21), Human

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 1890.00


货期*
2周

规格
    • 20 ug

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 16.2 kDa. The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis).
Purity >95% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to enhance IFN gamma secretion in NK-92 cells. The ED₅₀ for this effect is <10 ng/mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID Q9HBE4
Synonyms Za11
Summary Interleukin-21 (IL-21) belongs to the IL-15/IL-21 family, which exerts pleiotropic immune regulations. IL-21 produced primarily by natural killer T (NKT) cells, T follicular helper (TFH) cells and TH17 cells. As a pleiotropic cytokine, IL-21 has been shown to regulate both innate and humoral immunity. It has potent inhibitory activity towards the activation and maturation of granulocyte-macrophage colony-stimulating factor (GM-CSF)-induced dendritic cells (DCs). In B cells, IL-21 has a major role in the development of immunoglobulin responses. In T cells, it is required to facilitate the functional differentiation of several CD4+ T cell subsets. In addition, the ability of IL-21 to enhance the cytotoxic activity of both CD8+ T cells and NK cells makes it as a potential antitumor agent.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...