Recombinant IL-1RA (Interleukin-1 receptor antagonist),Human
CAT#: TP728247M
Recombinant IL-1RA (Interleukin-1 receptor antagonist),Human
|
Need it in bulk or customized? Get a free quote |
CNY 2000.00
货期*
2周
规格
Product images
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE with polyhistidine tag at the C-terminus.
|
| Tag | His Tag (C-term) |
| Predicted MW | The protein has a calculated MW of 18.07 kDa. The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >98% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to inhibit IL-1 alpha -dependent proliferation in D10.G4.1 cells. The ED₅₀ for this effect is <50 ng/mL. |
| Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | P18510 |
| Synonyms | ICIL-1RA, IRAP, IL-1RN |
| Summary | Interleukin 1 receptor antagonist (IL-1RA) is a 17.26 kDa member of IL-1 family with 153 amino acid residues. IL-1RA is expressed by peripheral blood cells, lungs, spleen, liver and is secreted from monocytes, macrophages, neutrophils, and other cells. Inhibits the activity of interleukin-1 by binding to receptor IL1R1. IL-1RA can modulate a variety of interleukin-1 related immune and inflammatory responses, particularly in the acute phase of infection and inflammation. |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
