Recombinant IL-19 (Interleukin-19), Human
CAT#: TP728246S
Recombinant IL-19 (Interleukin-19), Human
|
Need it in bulk or customized? Get a free quote |
CNY 700.00
货期*
2周
规格
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
MLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA with polyhistidinetag at the C-terminus.
|
| Tag | His Tag (C-term) |
| Predicted MW | The protein has a calculated MW of 18.69 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >98% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to induce proliferation in BaF3 cells transfected with human IL-20 R alpha and human IL-20 R beta. The ED₅₀ for this effect is <1.2 ng/mL. |
| Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | Q9UHD0 |
| Synonyms | Melanoma differentiation-associated protein-like protein |
| Summary | Interleukin 19 (IL-19) predicts a molecular mass of 35.8 kDa, is a type of anti-inflammatory cytokine. It promotes the Th2 T-cell response which supports an anti-inflammatory lymphocyte phenotype, dampens the Th1 T-cell response and IFNγ secretion, increases IL-10 expression in peripheral blood mononuclear cells, and inhibits the production of IgG from B cells. |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
