Recombinant IL-1 beta (Interleukin-1 beta), Human
CAT#: TP728234L
Recombinant IL-1 beta (Interleukin-1 beta), Human
|
Need it in bulk or customized? Get a free quote |
CNY 22000.00
货期*
2周
规格
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
MASAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS with polyhistidine tag at the C-terminus.
|
| Tag | His Tag (C-term) |
| Predicted MW | The protein has a calculated MW of 18.5 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >98% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to induce IL-8 secretion in HT29 cells. The ED₅₀ for this effect is <2.0 ng/mL. The specific activity of recombinant human IL-1 beta is approximately >3 x 10⁷ IU/mg. |
| Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | P01584 |
| Synonyms | Catabolin, Lymphocyte-Activating Factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endoge_x005f_x005f_x005f_x005f_x005f_x0002_nous Mediator (LEM), Mononuclear Cell Factor (MCF) |
| Summary | Interleukin-1 beta (IL-1β) is a major cytokine expressed in macrophage, NK cells, monocytes, and neutrophils. It also plays fundamental role in inflammatory response, including monocyte activation, which is essential for the host defense and pathogen and pathogen resistance. Pro-IL-1β is cleaved by cytosolic caspase 1 to form mature IL-1β. |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
