Recombinant IGF-I (Insulin-like growth factor-I),Human

CAT#: TP728231M

Recombinant IGF-I (Insulin-like growth factor-I),Human



Need it in bulk or customized?
Get a free quote

CNY 1000.00


货期*
2周

规格
    • 100 ug

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 8.59 kDa. The protein migrates as 8-10 kDa under reducing condition (SDS-PAGE analysis).
Purity >95% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce MCF-7 cells proliferation. The ED₅₀ for this effect is 0.9-3.1 ng/mL. The specific activity of recombinant human IGF-I is approximately >1.2 x 10³ IU/mg.
Endotoxin <0.01 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P05019
Synonyms Somatamedin C, IGF-IA
Summary Insulin like Growth Factors 1 (IGF-I) is a 7.79 kDa member of the Insulin-like Growth Factors with 71 amino acid residues. IGF-I is mainly expressed from liver, adipose tissue, Endometrial stromal cells, Leydig cells, and can be isolated from plasma. IGF-I mediating the protein anabolic and promoting effect of pituitary growth hormone. IGF-I also affects metabolism of glycogen, DNA synthesis and glucose uptake via binding to IGF-I receptor.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...