Recombinant Galectin-3, Human

CAT#: TP728214M

Recombinant Galectin-3, Human

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 4880.00


货期*
2周

规格
    • 100 ug

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI with polyhistidine tag at the N-terminus.
Tag His Tag (N-term)
Predicted MW The protein has a calculated MW of 27 kDa. The protein migrates as 32 kDa under reducing condition (SDS-PAGE analysis).
Purity >95% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measured by its ability to chemoattract human PBMC using a concentration range of 2.5-25 μg/mL. Note: Results may vary from different PBMC donors.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P17931
Synonyms IgE-binding protein, MAC2, L-29, CPB-35
Summary Galectin-3 (Gal-3) is one of the lectin family members, which is the only chimera‑type galectin, containing one carbohydrate recognition domain (CRD) connected to a long, flexible N‑terminal domain. The C‑terminal CRD is responsible for β-galactoside binding, and the N‑terminal domain is essential for its multimerization, and interaction with other intracellular proteins. Galectin-3 is predominantly presented in the cytoplasm and expressed on the cell surface, and then often secreted into biological fluids, such as serum and urine. Numerous studies have indicated that galectin-3 plays a crucial role in cell proliferation, apoptosis, gene expression, immune surveillance, inflammation, fibrosis, and host defense.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...