Recombinant FGF-23 (Fibroblast growth factor-23), Human
CAT#: TP728203S
Recombinant FGF-23 (Fibroblast growth factor-23), Human
|
Need it in bulk or customized? Get a free quote |
CNY 700.00
货期*
2周
规格
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
MYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI with polyhistidine tag at the C-terminus.
|
| Tag | His Tag (C-term) |
| Predicted MW | The protein has a calculated MW of 26.27 kDa. The protein migrates as 26 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >98% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to induce proliferation in BaF3 cells transfected with human FGFRIIIc. The ED₅₀ for this effect is <0.3 μg/mL. |
| Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | Q9GZV9 |
| Synonyms | FGFN |
| Summary | Fibroblast Growth Factors-23 (FGF-23) is a 28 kDa member of the fibroblast Growth Factors with 251 amino acid residues. FGF-23 is expressed from brain, hepatic stellate cells, cone photoreceptor cells, early spermatids. FGF-23 involved phosphate metabolism and vitamin D metabolism. Negatively regulates osteoblast differentiation and matrix mineralization. |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
