Recombinant FGF-14 (Fibroblast growth factor-14), Human
CAT#: TP728194M
Recombinant FGF-14 (Fibroblast growth factor-14), Human
|
Need it in bulk or customized? Get a free quote |
CNY 4880.00
货期*
2周
规格
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
AAAIASGLIRQKRQAREQHWDRPSASRRRSSPSKNRGLCNGNLVDIFSKVRIFGLKKRRLRRQDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKT with polyhistidine tag at the N-terminus.
|
| Tag | His Tag (N-term) |
| Predicted MW | The protein has a calculated MW of 28.28 kDa. The protein migrates as 33 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >95% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is <21 ng/mL. |
| Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | Q92915 |
| Synonyms | FHF-4, FHF4, SCA27 |
| Summary | Fibroblast Growth Factors-14 (FGF-14) is a 27.7 kDa member of the fibroblast Growth Factors with 247 amino acid residues. FGF-14 is mainly expressed from brain, cervix. FGF-14 involved in nervous system development and function. May regulate voltage-gated sodium channels transport and function. |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
