Recombinant FGF-11 isoform 1 (Fibroblast growth factor-11 isoform 1), Human
CAT#: TP728190L
Recombinant FGF-11 isoform 1 (Fibroblast growth factor-11 isoform 1), Human
|
Need it in bulk or customized? Get a free quote |
CNY 22000.00
货期*
2周
规格
Product images
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
MAALASSLIRQKREVREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLCGGRPARPDRGPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKLGHYMAMNAEGLLYSSPHFTAECRFKECVFENYYVLYASALYRQRRSGRAWYLGLDKEGQVMKGNRVKKTKAAAHFLPKLLEVAMYQEPSLHSVPEASPSSPPAP with polyhistidine tag at the C-terminus.
|
| Tag | His Tag (C-term) |
| Predicted MW | The protein has a calculated MW of 25.81 kDa. The protein migrates as 30 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >98% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is <0.2 ng/mL. |
| Endotoxin | <0.01 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | Q92914 |
| Synonyms | FHF-3, FHF3 |
| Summary | The Fibroblast Growth Factors (FGF) family has two group, secreted FGFs and intracellular FGFs (iFGFs). iFGFs are related to voltage-gated sodium (Nav) channels. Human FGF-11 isoform 1 is a 25 kDa cytokine with 225 amino acid residues. |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
