Recombinant CXCL5 (C-X-C motif chemokine 5), Human

CAT#: TP728181

Recombinant CXCL5 (C-X-C motif chemokine 5), Human

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 1890.00


货期*
2周

规格
    • 20 ug

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
RELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN with polyhistidine tag at the N-terminus.
Tag His Tag (N-term)
Predicted MW The protein has a calculated MW of 8.51 kDa. The protein migrates as 12 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED₅₀ for this effect is <10 ng/mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P42830
Synonyms Epithelial Neutrophil Activating Peptide-78, ENA-78
Summary C-X-C motif chemokine 5 (CXCL5) also named epithelial-derived neutrophil-activating peptide 78 (ENA-78), which is a chemokine of the intercrine alpha family. CXCL5 is a 8kDa protein containing 70 amino acid residues. CXCL5 is stimulated by the IL-1 or TNFα during inflammation which produced by the eosinophils and CXCL5 is inhibited by the IFNγ. CXCL5 promotes the formation of blood vessels and angiogenesis by binding the cell receptor CXCR2.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...