Recombinant CCL3 (C-C motif chemokine ligand 3),Human

CAT#: TP728166

Recombinant CCL3 (C-C motif chemokine ligand 3),Human

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 1890.00


货期*
2周

规格
    • 20 ug

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
ADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA with polyhistidine tag at the N-terminus
Tag His Tag (N-term)
Predicted MW The protein has a calculated MW of 8.4 kDa. The protein migrates as 8-11 kDa under reducing condition (SDS-PAGE analysis).
Purity >95% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1×PBS, pH 8.5.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to chemoattract human PBMC using a concentration range of 5 -50 ng/mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P10147
Synonyms MIP-1a: Macrophage Inflammatory Protein-1α, LD78α
Summary C-C Motif Chemokine Ligand 3 (CCL3) is a 7.33Da cytokine with 66 amino acid residues. CCL3 is also called macrophage inflammatory protein 1-alpha (MIP-1-alpha) and is expressed in bone marrow and liver. Upon binding to the receptor, CCR1, CCR4, or CCR5, CCL3 plays an essential role in acute inflammatory responses like recruitment and activation of polymorphonuclear leukocytes and induction of monophasic fever. In addition, CCL3 participates in resistance to type 1 virus infection, mediation of MAPK signaling pathway, cell-cell signaling, and calcium-mediated signaling.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...