Recombinant BMP-4 (Bone morphogenetic protein-4), Human

CAT#: TP728158S

Recombinant BMP-4 (Bone morphogenetic protein-4), Human

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 700.00


货期*
2周

规格
    • 5 ug

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 12.88 kDa. The protein migrates as 12 kDa under reducing condition (SDS-PAGE analysis).
Purity >95% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium carbonate, pH 9.0.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED₅₀ for this effect is <0.58 ng/mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P12644
Synonyms BMP-2B, DVR4
Summary Bone Morphogenetic Protein-4 (BMP-4) is an extracellular multifunctional signaling cytokine that is also a member of the TGF-β family. BMP-4 can bind with the TGF-β receptor and trigger SMAD protein signal transduction. BMP-4 has a significant expression in the prostate, it plays a vital role in the development of mesoderm into bones and the development of the epidermis and Dorsal-Ventral axis.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...