Sun3 (NM_177576) Mouse Recombinant Protein

CAT#: TP527552

Purified recombinant protein of Mouse Sad1 and UNC84 domain containing 3 (Sun3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR227552 protein sequence
Red=Cloning site Green=Tags(s)

MPKEQQELLKKESQTLENNFREILFLIEQIDVLKALLKDMKDGVHNHSLPVHRDAVQDQATTDVLDEEMS
NLVHYVLKKFRGDQIQLADYALKSAGASVIEAGTSESYKNNKAKLYWHGIGFLNYEMPPDMILQPDVHPG
KCWAFPGSQGHILIKLARKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGVMKKCEGEEIFLGQFIYNK
MEATIQTFELQNEASESLLCVKLQILSNWGHPKYTCLYRFRVHGIPSDYT

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 29.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_808244
Locus ID 194974
UniProt ID Q5SS91
Refseq Size 1205
Cytogenetics 11 A1
Refseq ORF 780
Synonyms Sunc1
Summary As a probable component of the LINC (LInker of Nucleoskeleton and Cytoskeleton) complex, involved in the connection between the nuclear lamina and the cytoskeleton. The nucleocytoplasmic interactions established by the LINC complex play an important role in the transmission of mechanical forces across the nuclear envelope and in nuclear movement and positioning. May be involved in nuclear remodeling during sperm head formation in spermatogenenis. A probable SUN3:SYNE1 LINC complex may tether spermatid nuclei to posterior cytoskeletal structures such as the manchette.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...