Fgf2 (NM_008006) Mouse Recombinant Protein
CAT#: TP527549
Purified recombinant protein of Mouse fibroblast growth factor 2 (Fgf2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
View other "Fgf2" proteins (2)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR227549 representing NM_008006
Red=Cloning site Green=Tags(s) MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGV VSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGP GQKAILFLPMSAKS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 17.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_032032 |
Locus ID | 14173 |
UniProt ID | P15655 |
Refseq Size | 695 |
Cytogenetics | 3 18.41 cM |
Refseq ORF | 462 |
Synonyms | bFGF; Fgf-2; Fgfb |
Summary | Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |