Ddit4 (NM_029083) Mouse Recombinant Protein
CAT#: TP527338
Purified recombinant protein of Mouse DNA-damage-inducible transcript 4 (Ddit4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
货期*
4周
规格
Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR227338 representing NM_029083
Red=Cloning site Green=Tags(s) MPSLWDRFSSSSSSSSSSRTPAADRPPRSAWGSAAREEGLDRCASLESSDCESLDSSNSGFGPEEDSSYL DGVSLPDFELLSDPEDEHLCANLMQLLQESLSQARLGSRRPARLLMPSQLVSQVGKELLRLAYSEPCGLR GALLDVCVEQGKSCHSVAQLALDPSLVPTFQLTLVLRLDSRLWPKIQGLLSSANSSLVPGYSQSLTLSTG FRVIKKKLYSSEQLLIEEC myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 25.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_083359 |
Locus ID | 74747 |
UniProt ID | Q9D3F7 |
Refseq Size | 1685 |
Cytogenetics | 10 B4 |
Refseq ORF | 687 |
Synonyms | 5830413E08Rik; AA415483; dig2; REDD1; Rtp801 |
Summary | Regulates cell growth, proliferation and survival via inhibition of the activity of the mammalian target of rapamycin complex 1 (mTORC1). Inhibition of mTORC1 is mediated by a pathway that involves DDIT4/REDD1, AKT1, the TSC1-TSC2 complex and the GTPase RHEB. Plays an important role in responses to cellular energy levels and cellular stress, including responses to hypoxia and DNA damage. Regulates p53/TP53-mediated apoptosis in response to DNA damage via its effect on mTORC1 activity. Its role in the response to hypoxia depends on the cell type; it mediates mTORC1 inhibition in fibroblasts and thymocytes, but not in hepatocytes. Inhibits neuronal differentiation and neurite outgrowth mediated by NGF via its effect on mTORC1 activity. Required for normal neuron migration during embryonic brain development. Plays a role in neuronal cell death. Required for mTORC1-mediated defense against viral protein synthesis and virus replication.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
You may also need
Customer
Reviews
Loading...