Hoxc8 (NM_010466) Mouse Recombinant Protein
CAT#: TP527253
Purified recombinant protein of Mouse homeobox C8 (Hoxc8), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR227253 representing NM_010466
Red=Cloning site Green=Tags(s) MSSYFVNPLFSKYKGGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNS GYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFP WMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNK DKLPGARDEEKVEEEGNEEEEKEEEEKEENKD myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 27.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_034596 |
| Locus ID | 15426 |
| UniProt ID | P09025 |
| Refseq Size | 2369 |
| Cytogenetics | 15 58.05 cM |
| Refseq ORF | 726 |
| Synonyms | D130011F21Rik; Hox-3.1 |
| Summary | Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
