Apod (NM_007470) Mouse Recombinant Protein
CAT#: TP527214
Purified recombinant protein of Mouse apolipoprotein D (Apod), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR227214 representing NM_007470
Red=Cloning site Green=Tags(s) MVTMLMFLATLAGLFTTAKGQNFHLGKCPSPPVQENFDVKKYLGRWYEIEKIPASFEKGNCIQANYSLME NGNIEVLNKELSPDGTMNQVKGEAKQSNVSEPAKLEVQFFPLMPPAPYWILATDYENYALVYSCTTFFWL FHVDFVWILGRNPYLPPETITYLKDILTSNGIDIEKMTTTDQANCPDFL myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 22 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_031496 |
| Locus ID | 11815 |
| UniProt ID | P51910 |
| Refseq Size | 1862 |
| Cytogenetics | 16 21.41 cM |
| Refseq ORF | 567 |
| Summary | The protein encoded by this gene is a component of high-density lipoprotein (HDL), but is unique in that it shares greater structural similarity to lipocalin than to other members of the apolipoprotein family, and has a wider tissue expression pattern. The encoded protein is involved in lipid metabolism, and ablation of this gene results in defects in triglyceride metabolism. Elevated levels of this gene product have been observed in multiple tissues of Niemann-Pick disease mouse models, as well as in some tumors. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2014] |
Documents
| FAQs |
| SDS |
