Ins2 (NM_001185083) Mouse Recombinant Protein
CAT#: TP526647
Purified recombinant protein of Mouse insulin II (Ins2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
货期*
4周
规格
推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR226647 representing NM_001185083
Red=Cloning site Green=Tags(s) MALWMRFLPLLALLFLWESHPTQAFVKQHLCGSHLVEALYLVCGERGFFYTPMSRREVEDPQVAQLELGG GPGAGDLQTLALEVAQQKRGIVDQCCTSICSLYQLENYCN myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 12.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001172012 |
| Locus ID | 16334 |
| UniProt ID | P01326 |
| Refseq Size | 455 |
| Cytogenetics | 7 88.0 cM |
| Refseq ORF | 330 |
| Synonyms | AA986540; In; Ins-2; InsII; Mod; Mody; Mody4 |
| Summary | This gene encodes insulin, a peptide hormone that plays a vital role in the regulation of carbohydrate and lipid metabolism. The encoded precursor protein undergoes proteolytic cleavage to produce a disulfide-linked heterodimeric functional protein that is stored in secretory granules. An increase in blood glucose levels, among others, induces the release of insulin from the secretory granules. Mice deficient in the functional hormone encoded by this gene develop diabetes mellitus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015] |
Documents
| FAQs |
| SDS |
You may also need
Customer
Reviews
Loading...
