Bmx (NM_009759) Mouse Recombinant Protein

CAT#: TP526349

Purified recombinant protein of Mouse BMX non-receptor tyrosine kinase (Bmx), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR226349 protein sequence
Red=Cloning site Green=Tags(s)

MESKSILEELLLKKSQQKKKMSPNNYKERLFVLTKTSLSYYEYDKMKRGSRKGSIEIKKIRCVEKVNLEE
QTPVERQYPFQIVYKDGLLYVYASNEESRCQWLKALQKEIRGNPHLLIKYHSGFFVDGKFLCCQQSCKAA
PGCTLWEAYADLHIAISDEKHRAPTFPERLLKIPRAVPVLKMDASSSGAILPQYDSYSKKSCGSQPTSNI
RYIPREDCPDWWQVRKLKSEEDIACSNQLERNIASHSTSKMSWGFPESSSSEEEENLHAYDWFAGNISRS
QSEQLLRQKGKEGAFMVRNSSQMGMYTVSLFSKAVNDKKGTVKHYHVHTNAENKLYLAENYCFDSIPKLI
HYHQHNSAGMITRLRHPVSTKANKVPVSVALGSGIWELKREEITLLKELGNGQFGVVQLGQWKGQYDVAV
KMIKEGAMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKKYPIYIVTEYITNGCLLNYLKSHGKGLESCQLL
EMCYDVCEGMAFLESHQFIHRDLAARNCLVDSDLSVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSAPEVF
HYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSEVVVKVSQGHRLYRPQLASDTIYQIMYSCWHELPE
KRPTFQQLLSAIEPLREQDKP

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 75 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_033889
Locus ID 12169
UniProt ID P97504
Refseq Size 3005
Cytogenetics X F5
Refseq ORF 1953
Synonyms Etk; Etk/Bmx; Tyro8
Summary Non-receptor tyrosine kinase that plays central but diverse modulatory roles in various signaling processes involved in the regulation of actin reorganization, cell migration, cell proliferation and survival, cell adhesion, and apoptosis. Participates in signal transduction stimulated by growth factor receptors, cytokine receptors, G-protein coupled receptors, antigen receptors and integrins. Induces tyrosine phosphorylation of BCAR1 in response to integrin regulation. Activation of BMX by integrins is mediated by PTK2/FAK1, a key mediator of integrin signaling events leading to the regulation of actin cytoskeleton and cell motility. Plays a critical role in TNF-induced angiogenesis, and implicated in the signaling of TEK and FLT1 receptors, 2 important receptor families essential for angiogenesis. Required for the phosphorylation and activation of STAT3, a transcription factor involved in cell differentiation. Also involved in interleukin-6 (IL6) induced differentiation. Plays also a role in programming adaptive cytoprotection against extracellular stress in different cell systems, salivary epithelial cells, brain endothelial cells, and dermal fibroblasts. May be involved in regulation of endocytosis through its interaction with an endosomal protein RUFY1. May also play a role in the growth and differentiation of hematopoietic cells; as well as in signal transduction in endocardial and arterial endothelial cells.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...