Clps (NM_025469) Mouse Recombinant Protein
CAT#: TP526150
Purified recombinant protein of Mouse colipase, pancreatic (Clps), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
货期*
4周
规格
Product images
推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR226150 representing NM_025469
Red=Cloning site Green=Tags(s) MEKVLVLLLVSLLAVAYAAPGPRGLIINLEDGEICLNSMQCKSRCCQHDTILGIARCTHKAMENSECSPK TLYGIYYRCPCERGLTCEGDRSIIGAITNTNYGICLDSRRSKQ myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 12.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_079745 |
| Locus ID | 109791 |
| UniProt ID | Q9CQC2 |
| Refseq Size | 494 |
| Cytogenetics | 17 A3.3 |
| Refseq ORF | 339 |
| Synonyms | 2200003J09Rik |
| Summary | This gene encodes a member of the colipase family of coenzymes that is required for the optimal activity of pancreatic lipase. The encoded protein undergoes proteolytic processing to generate a mature polypeptide that binds to the lipase and prevents inhibition by bile acids. Over half of the mice lacking the encoded protein die within two weeks of birth while the remaining ones exhibit fat malabsorption and altered body weight regulation. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Nov 2015] |
Documents
| FAQs |
| SDS |
You may also need
Customer
Reviews
Loading...
