Gnrh1 (NM_008145) Mouse Recombinant Protein
CAT#: TP526103
Purified recombinant protein of Mouse gonadotropin releasing hormone 1 (Gnrh1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
货期*
4周
规格
Product images
推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR226103 representing NM_008145
Red=Cloning site Green=Tags(s) MILKLMAGILLLTVCLEGCSSQHWSYGLRPGGKRNTEHLVESFQEMGKEVDQMAEPQHFECTVHWPRSPL RDLRGALESLIEEEARQKKM myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 10.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_032171 |
| Locus ID | 14714 |
| UniProt ID | P13562 |
| Refseq Size | 532 |
| Cytogenetics | 14 D1 |
| Refseq ORF | 270 |
| Synonyms | Gnrh; Gnrh2; hpg; L; LH; LHRH; Lhrh1; Lnrh |
| Summary | This gene encodes hypophysiotropic peptides belonging to the family of gonadotropin-releasing hormones that stimulate the release of gonadotropins and suppress secretion of prolactin from the pituitary gland. The encoded protein is proteolytically processed to generate two biologically active mature peptides. A deletional mutation encompassing the distal half of this gene in mice resulting in the loss of the encoded protein leads to hypogonadism and infertility. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015] |
Documents
| FAQs |
| SDS |
You may also need
Customer
Reviews
Loading...
