Sumo3 (NM_019929) Mouse Recombinant Protein
CAT#: TP525911
Purified recombinant protein of Mouse small ubiquitin-like modifier 3 (Sumo3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
货期*
4周
规格
Product images
推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR225911 protein sequence
Red=Cloning site Green=Tags(s) MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETD TPAQLEMEDEDTIDVFQQQTGGSASRGSVPTPNRCPDLCY myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 12.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_064313 |
| Locus ID | 20610 |
| UniProt ID | Q9Z172 |
| Refseq Size | 2630 |
| Cytogenetics | 10 39.72 cM |
| Refseq ORF | 330 |
| Synonyms | 2810014B19Rik; D10Ertd345; D10Ertd345e; SMT; SMT3A; Smt3h; Smt3h1; SUMO-3 |
| Summary | This gene encodes a member of the small ubiquitin-like modifier family. The encoded protein may regulate a variety of proteins in many pathways via a post-translational modification, known as SUMOylation. This activity may play a role in a wide variety of cellular processes, including nuclear transport, DNA replication and repair, mitosis, transcriptional regulation, and signal transduction. Disruption of some of these processes has been associated with cerebral ischemia, neural dysfunction, and heart disease. A pseudogene of this gene has been defined on the X chromosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2014] |
Documents
| FAQs |
| SDS |
You may also need
Customer
Reviews
Loading...
