Akt1s1 (NM_026270) Mouse Recombinant Protein
CAT#: TP525878
Purified recombinant protein of Mouse AKT1 substrate 1 (proline-rich) (Akt1s1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
货期*
现货
规格
推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR225878 protein sequence
Red=Cloning site Green=Tags(s) MASGRPEELWEAVVGAAERFQARTGTELVLLTAAPPPPPRPGPCAYAAHGRGALAEAARRCLHDIAQAHR AATATRPPGPPPAPQPPSPAPSPPPRPALAREDEEEDEDEPTETETSGERLGGSDNGGLFMMDEDATLQD LPPFCESDPESTDDGSLSEETPAGPTACPQPPATALPTQQYAKSLPVSVPVWAFKEKRTEARSSDEENGP PSSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRKY myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 27.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_080546 |
Locus ID | 67605 |
UniProt ID | Q9D1F4 |
Refseq Size | 1610 |
Cytogenetics | 7 B3 |
Refseq ORF | 771 |
Synonyms | 1110012J22Rik; AI227026; Lobe; Lobel; PRAS40 |
Summary | Subunit of mTORC1, which regulates cell growth and survival in response to nutrient and hormonal signals. mTORC1 is activated in response to growth factors or amino acids. Growth factor-stimulated mTORC1 activation involves a AKT1-mediated phosphorylation of TSC1-TSC2, which leads to the activation of the RHEB GTPase that potently activates the protein kinase activity of mTORC1. Amino acid-signaling to mTORC1 requires its relocalization to the lysosomes mediated by the Ragulator complex and the Rag GTPases. Activated mTORC1 up-regulates protein synthesis by phosphorylating key regulators of mRNA translation and ribosome synthesis. mTORC1 phosphorylates EIF4EBP1 and releases it from inhibiting the elongation initiation factor 4E (eiF4E). mTORC1 phosphorylates and activates S6K1 at 'Thr-389', which then promotes protein synthesis by phosphorylating PDCD4 and targeting it for degradation. Within mTORC1, AKT1S1 negatively regulates mTOR activity in a manner that is dependent on its phosphorylation state and binding to 14-3-3. Inhibits RHEB-GTP-dependent mTORC1 activation. Substrate for AKT1 phosphorylation, but can also be activated by AKT1-independent mechanisms. May also play a role in nerve growth factor-mediated neuroprotection.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
You may also need
Customer
Reviews
Loading...