Dmrt1 (NM_015826) Mouse Recombinant Protein

CAT#: TP525528

Purified recombinant protein of Mouse doublesex and mab-3 related transcription factor 1 (Dmrt1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
Rabbit Polyclonal Anti-Dmrt1 Antibody
    • 100 ul

CNY 5250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR225528 representing NM_015826
Red=Cloning site Green=Tags(s)

MPNDDTFGKPSTPTEVPHAPGAPPQGKAGGYSKAAGAMAGAAGGSGAGGSGGASGSGPSGLGSGSKKSPR
LPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCSLIAERQRVMAAQVALRRQQAQEEELGISHPIPLPSA
AELLVKRENNASNPCLMAENSSSAQPPPASTPTPAASEGRMVIQDIPAVTSRGHMENTSDLVSDPAYYSS
FYQPSLFPYYNNLYNYPQYSMALSAESSSGEVGNSLGGSPVKNSLRSLPAPYVPAQTGNQWQMKTSESRH
PVSSQYRMHSYYGPPSYLGQSMSQIFTFEEGPSYSEAKASVFSPPSSQDSGLVSLSSSSPMSNESSKGVL
ECESASSEPSSYAVNQVLEEDEDE

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Tag C-MYC/DDK
Predicted MW 39.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_056641
Locus ID 50796
UniProt ID Q9QZ59
Refseq Size 2251
Cytogenetics 19 B
Refseq ORF 1122
Summary Transcription factor that plays a key role in male sex determination and differentiation by controlling testis development and male germ cell proliferation. Plays a central role in spermatogonia by inhibiting meiosis in undifferentiated spermatogonia and promoting mitosis, leading to spermatogonial development and allowing abundant and continuous production of sperm. Acts both as a transcription repressor and activator: prevents meiosis by restricting retinoic acid (RA)-dependent transcription and repressing STRA8 expression and promotes spermatogonial development by activating spermatogonial differentiation genes, such as SOHLH1. Also plays a key role in postnatal sex maintenance by maintaining testis determination and preventing feminization: represses transcription of female promoting genes such as FOXL2 and activates male-specific genes. May act as a tumor suppressor. May also play a minor role in oogenesis.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...