Tnfsf13b (NM_033622) Mouse Recombinant Protein
CAT#: TP525393
Purified recombinant protein of Mouse tumor necrosis factor (ligand) superfamily, member 13b (Tnfsf13b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
View other "Tnfsf13b" proteins (1)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR225393 protein sequence
Red=Cloning site Green=Tags(s) MDESAKTLPPPCLCFCSEKGEDMKVGYDPITPQKEEGAWFGICRDGRLLAATLLLALLSSSFTAMSLYQL AALQADLMNLRMELQSYRGSATPAAAGAPELTAGVKLLTPAAPRPHNSSRGHRNRRAFQGPEETEQDVDL SAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIV VRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEG DEIQLAIPRENAQISRNGDDTFFGALKLL myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 34.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_296371 |
| Locus ID | 24099 |
| UniProt ID | Q9WU72 |
| Refseq Size | 1710 |
| Cytogenetics | 8 4.55 cM |
| Refseq ORF | 927 |
| Synonyms | BAFF; BLyS; D8Ertd387e; TALL-1; TALL1; THANK; TNFSF20; Tnlg7a; zTNF4 |
| Summary | Cytokine that binds to TNFRSF13B/TACI and TNFRSF17/BCMA. TNFSF13/APRIL binds to the same 2 receptors. Together, they form a 2 ligands -2 receptors pathway involved in the stimulation of B- and T-cell function and the regulation of humoral immunity. A third B-cell specific BAFF-receptor (BAFFR/BR3) promotes the survival of mature B-cells and the B-cell response.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| TP723868 | Purified recombinant protein of Mouse tumor necrosis factor (ligand) superfamily, member 13b (BAFF / Tnfsf13b) |
CNY 5240.00 |
其它Tnfsf13b产品
