Cracr2a (NM_001033464) Mouse Recombinant Protein
CAT#: TP524950
Purified recombinant protein of Mouse calcium release activated channel regulator 2A (Cracr2a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR224950 representing NM_001033464
Red=Cloning site Green=Tags(s) MATPSGREDSSSQTPGHGKQGSGACVEQLDHPEKLEVEMPDQSAMWKKAQEFFQTCDSEGKGFIARTDMQ RLHQELPLSLEELEDVFDALDADGNGFLTPEEFTTGFSHFFFSQNIQGEEEADQQVAQLQEEKVYQSRGE EDVGDMDHDEEAQFQMLMDRLGAQKVLEDESDVRQLWLQLRKDEPHLLSNFEDLLTTIFAQLQEAHEQKN ELECALRKKIAAYDEEIQHLYEEMEQQIKSEREQFLLKDTERFQARSRELEKKLSAKEQELERLNQKQRK VGYCGDIVGPQLFQLSLPLPHALHHSSMDF myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 35.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001028636 |
Locus ID | 381812 |
UniProt ID | Q3UP38 |
Refseq Size | 1094 |
Cytogenetics | 6 F3 |
Refseq ORF | 930 |
Synonyms | Efcab4b; Gm462; Gm1073 |
Summary | Ca(2+)-binding protein that plays a key role in store-operated Ca(2+) entry (SOCE) in T-cells by regulating CRAC channel activation. Acts as a cytoplasmic calcium-sensor that facilitates the clustering of ORAI1 and STIM1 at the junctional regions between the plasma membrane and the endoplasmic reticulum upon low Ca(2+) concentration. It thereby regulates CRAC channel activation, including translocation and clustering of ORAI1 and STIM1. Upon increase of cytoplasmic Ca(2+) resulting from opening of CRAC channels, dissociates from ORAI1 and STIM1, thereby destabilizing the ORAI1-STIM1 complex (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Cracr2a产品