Nfkbid (NM_172142) Mouse Recombinant Protein

CAT#: TP524785

Purified recombinant protein of Mouse nuclear factor of kappa light polypeptide gene enhancer in B cells inhibitor, delta (Nfkbid), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR224785 protein sequence
Red=Cloning site Green=Tags(s)

MEDSLDTRLYPEPSLSQVGSWRVSSLPSGSPQLPSPTGPSLETARAHILALGPQQLLAQDEEGDTLLHLF
AARGLRWAAYAAAEVLQMYRQLDIREHKGKTPLLVAAAANQPLIVEDLLSLGAEPNATDHQGRSVLHVAA
TYGLPGVLSAVFKSGIQVDLEARDFEGLTPLHTAVLALNAAMLPASVCPRMQNSQARDRLTCVQMLLQMG
ASHTSQEIKSNKTILHLAVQAANPTLVQLLLGLPRGDLWAFVNMKAHGNTALHMAAALPPGPPQEAIVRH
LLAAGADPTLRNLENEQPVHLLRPGPGPEGLRQLLKRSRTAPPGLSS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 35 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_742154
Locus ID 243910
UniProt ID Q2TB02
Refseq Size 2010
Cytogenetics 7 B1
Refseq ORF 981
Synonyms I-kappa-B-delta; IkappaBNS; ikB-delta
Summary Regulates the expression of IL-2, IL-6, and other cytokines through regulation on NF-kappa-B activity. Functions in the regulation of inflammatory responses (PubMed:11931770, PubMed:15749903, PubMed:16410444, PubMed:16413922, PubMed:17641034). Involved in the induction of T helper 17 cells (Th17) differentiation upon recognition of antigen by T cell antigen receptor (TCR) (PubMed:25282160). According to PubMed:11931770, it may also regulate TCR-induced negative selection of thymocytes (PubMed:11931770).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...