Nfkbid (NM_172142) Mouse Recombinant Protein
CAT#: TP524785
Purified recombinant protein of Mouse nuclear factor of kappa light polypeptide gene enhancer in B cells inhibitor, delta (Nfkbid), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR224785 protein sequence
Red=Cloning site Green=Tags(s) MEDSLDTRLYPEPSLSQVGSWRVSSLPSGSPQLPSPTGPSLETARAHILALGPQQLLAQDEEGDTLLHLF AARGLRWAAYAAAEVLQMYRQLDIREHKGKTPLLVAAAANQPLIVEDLLSLGAEPNATDHQGRSVLHVAA TYGLPGVLSAVFKSGIQVDLEARDFEGLTPLHTAVLALNAAMLPASVCPRMQNSQARDRLTCVQMLLQMG ASHTSQEIKSNKTILHLAVQAANPTLVQLLLGLPRGDLWAFVNMKAHGNTALHMAAALPPGPPQEAIVRH LLAAGADPTLRNLENEQPVHLLRPGPGPEGLRQLLKRSRTAPPGLSS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 35 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_742154 |
Locus ID | 243910 |
UniProt ID | Q2TB02 |
Refseq Size | 2010 |
Cytogenetics | 7 B1 |
Refseq ORF | 981 |
Synonyms | I-kappa-B-delta; IkappaBNS; ikB-delta |
Summary | Regulates the expression of IL-2, IL-6, and other cytokines through regulation on NF-kappa-B activity. Functions in the regulation of inflammatory responses (PubMed:11931770, PubMed:15749903, PubMed:16410444, PubMed:16413922, PubMed:17641034). Involved in the induction of T helper 17 cells (Th17) differentiation upon recognition of antigen by T cell antigen receptor (TCR) (PubMed:25282160). According to PubMed:11931770, it may also regulate TCR-induced negative selection of thymocytes (PubMed:11931770).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |