Plekho1 (NM_023320) Mouse Recombinant Protein
CAT#: TP524671
Purified recombinant protein of Mouse pleckstrin homology domain containing, family O member 1 (Plekho1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR224671 protein sequence
Red=Cloning site Green=Tags(s) MKKSGSGKRGPPDGNHQSAAPEKVGWVRKFCGKGIFREIWKNRYVVLKGDQLYVSEKEVKDEKNSQEVFD LSDYEKCEELRKSKSRSKKNHSKFTLARCRQPGTTAPNLIFLAVSPEEKESWINALSSAITRAKNRILDE VTVEEDSYLAHPTRDRAKIQHSRRPPTRGHLMAVASTSTSDGMLTLDLIQEEDPSPEEPASCAESFRVDL DKSVAQLAGSRRRADSDRIQPSSQRASSLSRPWEKPDKGAPYTPQALKKFPSTEKSRCASLEEILSQRDT APARPLHLQAEESLPPVPAQPGQLSRIQDLVARKLEKTQELLAEVQGLGDGKRKAKDPPQSPPDSESEQL LLETERLLGEASSNWSQAKRVLQEVRELRDLYRQMDLQTPDSHLRQTSQHSQYRKSLM myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 46 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_075809 |
| Locus ID | 67220 |
| UniProt ID | Q9JIY0 |
| Refseq Size | 1370 |
| Cytogenetics | 3 F2.1 |
| Refseq ORF | 1224 |
| Synonyms | 2810052M02Rik; CKIP-1; Ckip1; JZA-20; Jza2 |
| Summary | Plays a role in the regulation of the actin cytoskeleton through its interactions with actin capping protein (CP). May function to target CK2 to the plasma membrane thereby serving as an adapter to facilitate the phosphorylation of CP by protein kinase 2 (CK2). Appears to target ATM to the plasma membrane. Appears to also inhibit tumor cell growth by inhibiting AKT-mediated cell-survival. Also implicated in PI3K-regulated muscle differentiation, the regulation of AP-1 activity (plasma membrane bound AP-1 regulator that translocates to the nucleus) and the promotion of apoptosis induced by tumor necrosis factor TNF. When bound to PKB, it inhibits it probably by decreasing PKB level of phosphorylation (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Plekho1产品
