Plekho1 (NM_023320) Mouse Recombinant Protein

CAT#: TP524671

Purified recombinant protein of Mouse pleckstrin homology domain containing, family O member 1 (Plekho1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR224671 protein sequence
Red=Cloning site Green=Tags(s)

MKKSGSGKRGPPDGNHQSAAPEKVGWVRKFCGKGIFREIWKNRYVVLKGDQLYVSEKEVKDEKNSQEVFD
LSDYEKCEELRKSKSRSKKNHSKFTLARCRQPGTTAPNLIFLAVSPEEKESWINALSSAITRAKNRILDE
VTVEEDSYLAHPTRDRAKIQHSRRPPTRGHLMAVASTSTSDGMLTLDLIQEEDPSPEEPASCAESFRVDL
DKSVAQLAGSRRRADSDRIQPSSQRASSLSRPWEKPDKGAPYTPQALKKFPSTEKSRCASLEEILSQRDT
APARPLHLQAEESLPPVPAQPGQLSRIQDLVARKLEKTQELLAEVQGLGDGKRKAKDPPQSPPDSESEQL
LLETERLLGEASSNWSQAKRVLQEVRELRDLYRQMDLQTPDSHLRQTSQHSQYRKSLM

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 46 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_075809
Locus ID 67220
UniProt ID Q9JIY0
Refseq Size 1370
Cytogenetics 3 F2.1
Refseq ORF 1224
Synonyms 2810052M02Rik; CKIP-1; Ckip1; JZA-20; Jza2
Summary Plays a role in the regulation of the actin cytoskeleton through its interactions with actin capping protein (CP). May function to target CK2 to the plasma membrane thereby serving as an adapter to facilitate the phosphorylation of CP by protein kinase 2 (CK2). Appears to target ATM to the plasma membrane. Appears to also inhibit tumor cell growth by inhibiting AKT-mediated cell-survival. Also implicated in PI3K-regulated muscle differentiation, the regulation of AP-1 activity (plasma membrane bound AP-1 regulator that translocates to the nucleus) and the promotion of apoptosis induced by tumor necrosis factor TNF. When bound to PKB, it inhibits it probably by decreasing PKB level of phosphorylation (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...