Zbtb8os (NM_025970) Mouse Recombinant Protein
CAT#: TP524396
Purified recombinant protein of Mouse zinc finger and BTB domain containing 8 opposite strand (Zbtb8os), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR224396 representing NM_025970
Red=Cloning site Green=Tags(s) MAQEEEDVRDYNLTEEQKATKDKYPPVNRKYEYLDHTADVQLHAWGDTLEEAFEQCAMAMFGYMTDTGTV EPLRTVEVETQGDDLQSLLFHFLDEWLYKFSADEYFIPREVKVLNIDQKNFKLRSIGWGEEFSLSKHPQG TEVKAITYSAMQVYNEEKPEVFVIIDI myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 20 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_080246 |
Locus ID | 67106 |
UniProt ID | Q505B7, B2KGA7 |
Refseq Size | 660 |
Cytogenetics | 4 D2.2 |
Refseq ORF | 501 |
Synonyms | 2010001H09Rik; 2310028N13Rik; AI851226; Arch; Archm |
Summary | Component of the tRNA-splicing ligase complex required to facilitate the enzymatic turnover of catalytic subunit RTCB. Together with DDX1, acts by facilitating the guanylylation of RTCB, a key intermediate step in tRNA ligation (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Zbtb8os产品