Tm4sf20 (NM_025453) Mouse Recombinant Protein
CAT#: TP524367
Purified recombinant protein of Mouse transmembrane 4 L six family member 20 (Tm4sf20), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR224367 representing NM_025453
Red=Cloning site Green=Tags(s) MTCCEGWTSCNGFSLLILILLGVVINCIPLGISLVEADSTSQNPISCYEWWFPGIIGAGLMAIPATTMSL AARKRACCNNKTGMFLSSLFSVITVVGAVYCMLVSLQALLEGPLICNTQANSTVTCEFSLKNLSKFDPES FNLLWFFNGTCVSPTDFKNPTINNMVSNWKIPNSNSEEDRHRIFHFSVFMSLLLVGILELLFGLSQILIG FLGCLCGVSQRRSQIV myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 25.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_079729 |
| Locus ID | 66261 |
| UniProt ID | Q9CQY8 |
| Refseq Size | 1503 |
| Cytogenetics | 1 C5 |
| Refseq ORF | 678 |
| Synonyms | 1810018L02Rik |
| Summary | Polytopic transmembrane protein. Inhibits regulated intramembrane proteolysis (RIP) of CREB3L1, inhibiting its activation and the induction of collagen synthesis. In response to ceramide, which alters TM4SF20 membrane topology, stimulates RIP activation of CREB3L1. Ceramide reverses the direction through which transmembrane helices are translocated into the endoplasmic reticulum membrane during translation of TM4SF20, this mechanism is called 'regulated alternative translocation' (RAT) and regulates the function of the transmembrane protein.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Tm4sf20产品
