Gldn (NM_177350) Mouse Recombinant Protein

CAT#: TP524196

Purified recombinant protein of Mouse gliomedin (Gldn), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR224196 representing NM_177350
Red=Cloning site Green=Tags(s)

MTRAAERGQGATGWGLRGALVAIALLSALNAAGTVFVLCQWRGLSAALRALEAQRGREQREDSALRAFLA
ELSRAPGRVPEPSQDPMSAARNKRSHNGEPASHIRAESQDMMMMMTYSMVPIRVMIDLCNSTQGICLTGP
PGPPGPPGAGGLPGHNGSDGQPGLQGPKGEKGAIGKRGKMGLPGATGNPGEKGEKGDAGELGLPGNEGPP
GQKGDKGDKGDVSNDVLLTGAKGDQGPPGPPGPPGPPGPPGSRRSKGPRPPNVFNSQCPGETCVIPNDDT
LVGRADEKANERHSPQTESMITSIGNPAQVLKVRETFGTWMRESANKSDDRIWVTEHFSGIMVKEFKDLP
ALLNSSFTLLHLPHYFHGCGHAVYNNSLYYHKGGSNTIVRFEFGKETPQTLKLENALYFDRKYLFANSKT
YFNIAVDEKGIWIIYASSVDGSSILVAQLDERTFSVTQHINTTYPKSKAGNAFIARGILYVTDTKDTRVT
FAFDLLGGKQINANFDFRMSQSVLAMLSYNMRDQHLYSWEDGHLMLYPVQFLSAASSQR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 59.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_796324
Locus ID 235379
UniProt ID Q8BMF8
Refseq Size 4649
Cytogenetics 9 A5.3
Refseq ORF 1647
Synonyms Clom; Colm; CRG-L2; Crgl2; Crlg2
Summary Ligand for NRCAM and NFASC/neurofascin that plays a role in the formation and maintenance of the nodes of Ranvier on myelinated axons. Mediates interaction between Schwann cell microvilli and axons via its interactions with NRCAM and NFASC (PubMed:20188654). Nodes of Ranvier contain clustered sodium channels that are crucial for the saltatory propagation of action potentials along myelinated axons. During development, nodes of Ranvier are formed by the fusion of two heminodes. Required for normal clustering of sodium channels at heminodes; not required for the formation of mature nodes with normal sodium channel clusters (PubMed:20188654). Required, together with NRCAM, for maintaining NFASC and sodium channel clusters at mature nodes of Ranvier (PubMed:24719088).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...