Il25 (NM_080729) Mouse Recombinant Protein
CAT#: TP524044
Purified recombinant protein of Mouse interleukin 25 (Il25), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
View other "Il25" proteins (1)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR224044 protein sequence
Red=Cloning site Green=Tags(s) MYQAVAFLAMIVGTHTVSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASK DGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGE EGTHRRYCLERRLYRVSLACVCVRPRVMA myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 19.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_542767 |
| Locus ID | 140806 |
| UniProt ID | Q8VHH8 |
| Refseq Size | 1064 |
| Cytogenetics | 14 C2 |
| Refseq ORF | 507 |
| Synonyms | IL-17e; Il17e |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| TP723839 | Purified recombinant protein of Mouse interleukin 25 (Il25 / IL-17E) |
CNY 5330.00 |
